{"product_id":"proteintech-10081-1-ap","title":"Proteintech, 10081-1-AP, GNB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNB3 (10081-1-AP) by Proteintech is a Polyclonal antibody targeting GNB3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10081-1-AP targets GNB3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse embryo tissue,  rat brain tissue,  mouse cerebellum tissue,  mouse eye tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGuanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0127 Product name: Recombinant human GNB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-270 aa of BC000115 Sequence: MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESII Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), beta polypeptide 3\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 35-37 kDa\nGenBank Accession Number: BC000115\nGene Symbol: GNB3\nGene ID (NCBI): 2784\nRRID: AB_2263264\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16520\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868941406377,"sku":"10081-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10081-1-ap","provider":"Iright","version":"1.0","type":"link"}