{"product_id":"proteintech-10090-2-ap","title":"Proteintech, 10090-2-AP, ARL2BP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL2BP (10090-2-AP) by Proteintech is a Polyclonal antibody targeting ARL2BP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10090-2-AP targets ARL2BP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  Calu-1 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARF-like proteins (ARLs) belong to a group of incompletely characterized members in the ARF family of RAS-related GTPases. A 19-kDa protein (BART, Binder of Arl Two) was identified to bind specifically to ARL2.GDP with high affinity but not with ARL2.GDP. In human, the 489-base pair BART open reading frame encodes a novel 163-amino acid protein with a predicted molecular mass of 18,822 Da. Data from Northern and Western analyses indicated BART is expressed in many tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0138 Product name: Recombinant human ARL2BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC003087 Sequence: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH Predict reactive species\nFull Name: ADP-ribosylation factor-like 2 binding protein\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19-21 kDa\nGenBank Accession Number: BC003087\nGene Symbol: ARL2BP\nGene ID (NCBI): 23568\nRRID: AB_2058518\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2Y0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868977090729,"sku":"10090-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10090-2-ap","provider":"Iright","version":"1.0","type":"link"}