{"product_id":"proteintech-10108-2-ap","title":"Proteintech, 10108-2-AP, CX3CL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CX3CL1 (10108-2-AP) by Proteintech is a Polyclonal antibody targeting CX3CL1 in WB, IHC, ELISA applications with reactivity to human samples\n10108-2-AP targets CX3CL1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, human brain tissue\nPositive IHC detected in: human small intestine tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChemokines direct the trafficking of white blood cells in immune surveillance, playing a key role in inflammatory and infectious diseases such as AIDS. The human CX3C chemokine carries the chemokine domain on top of an extended mucin-like stalk. CX3CL1 is synthesized as a 50-75 kDa precursor and undergoes glycosylation to yield two mature forms: a 100 kDa cell membrane bound form and an 85 kDa soluble form which is released from the cell surface. The soluble CX3C chemokine has potent chemoattractant activity for T cells and monocytes, and the cell-surface-bound protein, which is induced by primary proinflammatory signals in activated primary endothelial cells, promotes strong adhesion of those leukocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0161 Product name: Recombinant human CX3CL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-245 aa of BC001163 Sequence: DRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQ Predict reactive species\nFull Name: chemokine (C-X3-C motif) ligand 1\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: BC001163\nGene Symbol: CX3CL1\nGene ID (NCBI): 6376\nRRID: AB_2087154\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78423\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868833796265,"sku":"10108-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10108-2-ap","provider":"Iright","version":"1.0","type":"link"}