{"product_id":"proteintech-10116-1-ap","title":"Proteintech, 10116-1-AP, GDI2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GDI2 (10116-1-AP) by Proteintech is a Polyclonal antibody targeting GDI2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10116-1-AP targets GDI2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, rat brain tissue,  mouse spleen tissue,  rat spleen tissue,  HeLa cells,  mouse brain tissue\nPositive IHC detected in: human gliomas tissue, human colon tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:200-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI2 distributes ubiquitously, displaying a membrane bound location in perinuclear regions of cells. GDI-2 was thought to be involved in cellular response to insulin. It electrophoreses as a 46kd protein in SDS-PAGE. (PMID: 7929030; PMID: 19570034). This antibody can bind both GDIs for the close sequences.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey, yeast\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0170 Product name: Recombinant human GDI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC005145 Sequence: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGEL Predict reactive species\nFull Name: GDP dissociation inhibitor 2\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC005145\nGene Symbol: GDI2\nGene ID (NCBI): 2665\nRRID: AB_2279073\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50395\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868897333417,"sku":"10116-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10116-1-ap","provider":"Iright","version":"1.0","type":"link"}