{"product_id":"proteintech-10134-1-ap","title":"Proteintech, 10134-1-AP, LSM8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSM8 (10134-1-AP) by Proteintech is a Polyclonal antibody targeting LSM8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10134-1-AP targets LSM8 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HL-60 cells\nPositive IHC detected in: human kidney tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:750-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing[PMID:15075370].  Lsm2-Lsm8 (Lsm stands for Like Sm), binds and stabilizes the 3′ end of the spliceosomal U6 snRNA Lsm proteins facilitate the annealing of U6 snRNA with U4 snRNA in vitro and interact with the U4\/U6 annealing factor Prp24, suggesting that Lsm proteins function in U4\/U6 snRNP formation in vivo [PMID:15485930, 17251193].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0178 Product name: Recombinant human LSM8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC002742 Sequence: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH Predict reactive species\nFull Name: LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae)\nCalculated Molecular Weight: 14 kDa \/75 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC002742\nGene Symbol: LSM8\nGene ID (NCBI): 51691\nRRID: AB_513438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95777\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869556330665,"sku":"10134-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10134-1-ap","provider":"Iright","version":"1.0","type":"link"}