{"product_id":"proteintech-10138-1-ap","title":"Proteintech, 10138-1-AP, HVEM\/TNFRSF14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HVEM\/TNFRSF14 (10138-1-AP) by Proteintech is a Polyclonal antibody targeting HVEM\/TNFRSF14 in IHC, ELISA applications with reactivity to human samples\n10138-1-AP targets HVEM\/TNFRSF14 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mammalian tumor necrosis factor receptor (TNFR) family consists of 10 cell-surface proteins that regulate development and homeostasis of the immune system. Member 14 of TNFR (TNFRSF14, also named as TR2, ATAR, HVEA, HVEM, LIGHTR) was also identified as a mediator of herpesvirus entry into mammalian cells. The cytoplasmic region of TNFRSF14 bound to several members of the TNFR-associated factor (TRAF) family, namely TRAF1, TRAF2, TRAF3, and TRAF5. Transient transfection into human 293 cells caused marked activation of nuclear factor- B (NF- B), a transcriptional regulator of multiple immunomodulatory and inflammatory genes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0186 Product name: Recombinant human TNFRSF14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC002794 Sequence: MEPPGDWGPPPWRSTPRTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCS Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)\nCalculated Molecular Weight: 30 kDa\nGenBank Accession Number: BC002794\nGene Symbol: TNFRSF14\nGene ID (NCBI): 8764\nRRID: AB_2203686\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92956\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868982759593,"sku":"10138-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10138-1-ap","provider":"Iright","version":"1.0","type":"link"}