{"product_id":"proteintech-10146-2-ap","title":"Proteintech, 10146-2-AP, PREB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PREB (10146-2-AP) by Proteintech is a Polyclonal antibody targeting PREB in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10146-2-AP targets PREB in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, 3T3-L1 cells ,  HT-1080 cells,  HepG2 cells\nPositive IP detected in: SKOV-3 cells\nPositive IHC detected in: mouse intestine, human ovary tumor tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPREB contains two PQ-rich potential transactivation domains, but no apparent DNA-binding motif, and exhibits sequence-specific binding to Pit1-binding element of the prolactin (PRL) promoter. It may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0202 Product name: Recombinant human PREB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-202 aa of BC002765 Sequence: PFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDL Predict reactive species\nFull Name: prolactin regulatory element binding\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC002765\nGene Symbol: PREB\nGene ID (NCBI): 10113\nRRID: AB_2168779\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HCU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868959625385,"sku":"10146-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10146-2-ap","provider":"Iright","version":"1.0","type":"link"}