{"product_id":"proteintech-10147-1-ap","title":"Proteintech, 10147-1-AP, t-Plasminogen activator\/tPA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe t-Plasminogen activator\/tPA (10147-1-AP) by Proteintech is a Polyclonal antibody targeting t-Plasminogen activator\/tPA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n10147-1-AP targets t-Plasminogen activator\/tPA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse pancreas tissue,  rat kidney tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPlasminogen activator, tissue (PLAT, synonyms: TPA, T-PA) is a  tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein (33 kDa and 32 kDa). PLAT enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. tPA has 4 isoforms produced by alternative splicing with the MW of 63 kDa, 33 kDa, 57 kDa and 44 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0200 Product name: Recombinant human PLAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 359-516 aa of BC002795 Sequence: NDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP Predict reactive species\nFull Name: plasminogen activator, tissue\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 32-35 kDa, 65 kDa\nGenBank Accession Number: BC002795\nGene Symbol: tPA\nGene ID (NCBI): 5327\nRRID: AB_2299701\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00750\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868859584681,"sku":"10147-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10147-1-ap","provider":"Iright","version":"1.0","type":"link"}