{"product_id":"proteintech-10161-1-ap","title":"Proteintech, 10161-1-AP, TAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAP2 (10161-1-AP) by Proteintech is a Polyclonal antibody targeting TAP2 in WB, IHC, ELISA applications with reactivity to human samples\n10161-1-AP targets TAP2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, SH-SY5Y cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAP2, also known as APT2, ABCB3, is a member of the superfamily of ATP-binding cassette (ABC) transporters. TAP2 mediates unidirectional translocation of peptide antigens from cytosol to endoplasmic reticulum (ER) for loading onto MHC class I (MHCI) molecules (PMID: 25656091). Mutations in TAP2 may be associated with Bare lymphocyte syndrome 1 (BLS1) and schizophrenia(PMID: 7517574, 24365204).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0190 Product name: Recombinant human TAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-223 aa of BC002751 Sequence: MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINL Predict reactive species\nFull Name: transporter 2, ATP-binding cassette, sub-family B (MDR\/TAP)\nCalculated Molecular Weight: 76 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC002751\nGene Symbol: TAP2\nGene ID (NCBI): 6891\nRRID: AB_3085365\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q03519\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869611315369,"sku":"10161-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10161-1-ap","provider":"Iright","version":"1.0","type":"link"}