{"product_id":"proteintech-10167-1-ap","title":"Proteintech, 10167-1-AP, SERTAD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SERTAD1 (10167-1-AP) by Proteintech is a Polyclonal antibody targeting SERTAD1 in IHC, ELISA applications with reactivity to human, mouse samples\n10167-1-AP targets SERTAD1 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse heart tissue, mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSERTA domain containing 1 (SERTAD1, synonyms: SEI1, TRIP-Br1) protein is a cyclin-dependent kinase 4 (cdk4)-binding protein and acts as a growth factor sensor and facilitates the formation and activation of cyclin D-CDK complexes in the face of inhibitory levels of INK4 proteins, therefore, antagonizes the activity of p16(INK4a) tumor suppressor. SERTAD1 also suppresses CREB-mediated transcription and regulates cell cycle progression through sequential effects on the transcriptional activity of E2F-responsive promoters during G(1) and S phases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0180 Product name: Recombinant human SERTAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC002670 Sequence: MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSLQQSEPDLRHLVLVVNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGPPGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPG Predict reactive species\nFull Name: SERTA domain containing 1\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC002670\nGene Symbol: SERTAD1\nGene ID (NCBI): 29950\nRRID: AB_2285697\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887797784745,"sku":"10167-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10167-1-ap","provider":"Iright","version":"1.0","type":"link"}