{"product_id":"proteintech-10169-2-ap","title":"Proteintech, 10169-2-AP, HSBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSBP1 (10169-2-AP) by Proteintech is a Polyclonal antibody targeting HSBP1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10169-2-AP targets HSBP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  HT-1080 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse liver tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0225 Product name: Recombinant human HSBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC007515 Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS Predict reactive species\nFull Name: heat shock factor binding protein 1\nCalculated Molecular Weight: 8.5 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC007515\nGene Symbol: HSBP1\nGene ID (NCBI): 3281\nRRID: AB_2119501\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75506\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869549187241,"sku":"10169-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10169-2-ap","provider":"Iright","version":"1.0","type":"link"}