{"product_id":"proteintech-10170-1-ap","title":"Proteintech, 10170-1-AP, Complement factor B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Complement factor B (10170-1-AP) by Proteintech is a Polyclonal antibody targeting Complement factor B in WB, IHC, ELISA applications with reactivity to human, rat samples\n10170-1-AP targets Complement factor B in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, human blood,  rat plasma\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is a 93-100 kDa glycoprotein and is cleaved into Ba (33 kDa) and Bb (60 kDa) by factor D in the presence of C3b (PMID: 11025450). The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This antibody raised against 573-761aa of human complement factor B can recognize complement factor B and Bb fragment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0226 Product name: Recombinant human CFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 574-762 aa of BC007990 Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG Predict reactive species\nFull Name: complement factor B\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 93-100 kDa, 60-69 kDa\nGenBank Accession Number: BC007990\nGene Symbol: Complement factor B\nGene ID (NCBI): 629\nRRID: AB_2082384\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00751\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868923809961,"sku":"10170-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10170-1-ap","provider":"Iright","version":"1.0","type":"link"}