{"product_id":"proteintech-10171-1-ap","title":"Proteintech, 10171-1-AP, Beta Arrestin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Beta Arrestin 2 (10171-1-AP) by Proteintech is a Polyclonal antibody targeting Beta Arrestin 2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10171-1-AP targets Beta Arrestin 2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, RAW264.7,  PC-12 cells,  rat brain tissue\nPositive IHC detected in: human tonsil tissue, human malignant melanoma tissue,  human colon cancer tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, mouse Retina tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBeta Arrestin 2 is a member of arrestin\/beta-arrestin protein family, which are expressed at high levels in the central nervous system (CNS) and play a critical role in the regulation of G-protein coupled receptors (GPCRs) including MOR. Beta Arrestin 2 is an adaptor protein that is important for the regulation of receptors belonging to both dopaminergic and opioid systems. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, hamster, xenopus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0227 Product name: Recombinant human Beta Arrestin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-409 aa of BC007427 Sequence: NSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC Predict reactive species\nFull Name: arrestin, beta 2\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC007427\nGene Symbol: Beta Arrestin 2\nGene ID (NCBI): 409\nRRID: AB_10644158\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32121\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868857454761,"sku":"10171-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10171-1-ap","provider":"Iright","version":"1.0","type":"link"}