{"product_id":"proteintech-10173-1-ap","title":"Proteintech, 10173-1-AP, GTF2H1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GTF2H1 (10173-1-AP) by Proteintech is a Polyclonal antibody targeting GTF2H1 in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n10173-1-AP targets GTF2H1 in WB, IHC, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse brain tissue,  HepG2 cells,  HL-60 cells,  rat brain tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTFIIH is a multiprotein complex that has a central role in the RNA pol II mediated transcription, in DNA repair and in the control of the cell cycle. TFIIH consists of nine subunits: cyclin-dependent kinase 7 (Cdk7), cyclin H and MAT1 (forming the Cdk-activating-kinase or CAK complex), the two helicases Xpb\/Hay and Xpd, and p34, p44, p52 and p62. As the kinase subunit of TFIIH, Cdk7 participates in basal transcription by phosphorylating the carboxy-terminal domain of the largest subunit of RNA polymerase II. Mutations in some components of TFIIH are associated with three hereditary human syndromes: xeroderma pigmentosum (XP), Cockayne syndrome (CS) and trichothiodystrophy (TTD). The p62 protein (TFIIH1) is a structural component of the TFIIH core and no syndromes have been identified up to date by mutations in this human gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0229 Product name: Recombinant human GTF2H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-545 aa of BC004452 Sequence: HRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQVLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLM Predict reactive species\nFull Name: general transcription factor IIH, polypeptide 1, 62kDa\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC004452\nGene Symbol: GTF2H1\nGene ID (NCBI): 2965\nRRID: AB_2295009\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32780\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869690646697,"sku":"10173-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10173-1-ap","provider":"Iright","version":"1.0","type":"link"}