{"product_id":"proteintech-10183-1-ap","title":"Proteintech, 10183-1-AP, DIDO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DIDO1 (10183-1-AP) by Proteintech is a Polyclonal antibody targeting DIDO1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10183-1-AP targets DIDO1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDIDO1, also termed DATF-1, C20orf158, DATF1, KIAA0333 and DIO-1, is a putative transcription factor, weakly pro-apoptotic when overexpressed. It is a tumor suppressor. In mice, DIDO1 is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. The human DIDO1 is similar to the mouse gene and therefore is thought to be involved in apoptosis. DIDO1 has multiple isoforms with molecular weights of 243 kd, 129 kd, 59 kd, and 61 kd. DIDO1 undergoes various modifications, including phosphorylation and ubiquitination, resulting in a mainstream molecular weight of 300 kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0237 Product name: Recombinant human DIDO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 345-544 aa of BC000770 Sequence: ADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILKHAAATMKFLSSGKEQKPKPKEKMKMKPEKPSLPKCGAQAGIKISSVHKRPAPEKKETTVKKAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKCSGKYLYSLHPSLIA Predict reactive species\nFull Name: death inducer-obliterator 1\nCalculated Molecular Weight: 244 kDa\nObserved Molecular Weight: 300-350 kDa\nGenBank Accession Number: BC000770\nGene Symbol: DIDO1\nGene ID (NCBI): 11083\nRRID: AB_2277375\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BTC0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887191216297,"sku":"10183-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10183-1-ap","provider":"Iright","version":"1.0","type":"link"}