{"product_id":"proteintech-10185-1-ap","title":"Proteintech, 10185-1-AP, RNF216 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF216 (10185-1-AP) by Proteintech is a Polyclonal antibody targeting RNF216 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10185-1-AP targets RNF216 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, U2OS cells,  SW480 cells,  mouse kidney tissue,  rat heart tissue\nPositive IP detected in: SW480 cells\nPositive IHC detected in: mouse brain tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF216\/TRIAD3 is an RBR (RING-between-RING) E3 ligase that encodes for multiple isoforms that include TRIAD3A, TRIAD3B, TRIAD3C and TRIAD3D\/E. RNF216 is a broadly expressed RBR E3 ligase, and loss-of-function mutations in RNF216 are linked to the neurode-generative conditions Gordon-Holmes syndrome (GHS) and Huntington-like disorders (PMID: 34998453, 35620441). RNF216 has three different molecular weights, 99 kDa, 106 kDa and 57 kDa, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0238 Product name: Recombinant human RNF216 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-276 aa of BC000787 Sequence: KRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTS Predict reactive species\nFull Name: ring finger protein 216\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 57 kDa, 90-99 kDa, 106~130 kDa\nGenBank Accession Number: BC000787\nGene Symbol: RNF216\nGene ID (NCBI): 54476\nRRID: AB_2180806\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NWF9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869756674217,"sku":"10185-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10185-1-ap","provider":"Iright","version":"1.0","type":"link"}