{"product_id":"proteintech-10202-1-ap","title":"Proteintech, 10202-1-AP, ARL4C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL4C (10202-1-AP) by Proteintech is a Polyclonal antibody targeting ARL4C in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10202-1-AP targets ARL4C in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, human brain tissue\nPositive IP detected in: HUVEC cells\nPositive IHC detected in: human colon cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0246 Product name: Recombinant human ARL4C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-174 aa of BC001051 Sequence: MLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKK Predict reactive species\nFull Name: ADP-ribosylation factor-like 4C\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21-25 kDa\nGenBank Accession Number: BC001051\nGene Symbol: ARL4C\nGene ID (NCBI): 10123\nRRID: AB_2058661\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56559\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868915617961,"sku":"10202-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10202-1-ap","provider":"Iright","version":"1.0","type":"link"}