{"product_id":"proteintech-10207-2-ap","title":"Proteintech, 10207-2-AP, UBE2V1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2V1 (10207-2-AP) by Proteintech is a Polyclonal antibody targeting UBE2V1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n10207-2-AP targets UBE2V1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HeLa cells,  mouse brain tissue,  mouse kidney tissue,  rat brain tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE2V1(Ubiquitin-conjugating enzyme E2 variant 1) is also named as CROC1, UBE2V, UEV1 and belongs to the ubiquitin-conjugating enzyme family. It has no ubiquitin ligase activity on its own and the UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. CROC1 transcripts in all human tissues examined, with highest levels in brain, skeletal muscle, and kidney(PMID:9305758). It has 5 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0278 Product name: Recombinant human UBE2V1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-109 aa of BC000468 Sequence: LLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLA Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2 variant 1\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC000468\nGene Symbol: UBE2V1\nGene ID (NCBI): 7335\nRRID: AB_2272560\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13404\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887913521321,"sku":"10207-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10207-2-ap","provider":"Iright","version":"1.0","type":"link"}