{"product_id":"proteintech-10209-2-ap","title":"Proteintech, 10209-2-AP, CIRBP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIRBP (10209-2-AP) by Proteintech is a Polyclonal antibody targeting CIRBP in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n10209-2-AP targets CIRBP in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells, A549 cells,  HEK-293 cells,  HepG2 cells,  PC-12 cells,  PC-13 cells,  mouse testis tissue,  rat testis tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human pancreas cancer tissue, human breast cancer tissue,  mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells, HEK-293 cells,  HepG2 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCIRBP, also named as A18HNRNP and CIRP, is a cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival[PMID: 19158277]. CIRBP is also involved in cap-independent translation upon moderate cold-shock. It acts as a translational activator. CIRBP is a suppressive rather stimulatory effect on proliferation[PMID: 19777567]. CIRBP can translocate from nucleus to cytoplasm under stresses such as UV irradation or heat shock. Suppression of CIRBP increased the apoptotic cell population of neural stem cells at moderate low temperature[PMID: 20735994]. This antibody (Catalog# 10209-2-AP) is a rabbit polyclonal antibody raised against the full-length CIRBP of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, squirrel\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0280 Product name: Recombinant human CIRBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC000403 Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE Predict reactive species\nFull Name: cold inducible RNA binding protein\nCalculated Molecular Weight: 172 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC000403\nGene Symbol: CIRBP\nGene ID (NCBI): 1153\nRRID: AB_2080263\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14011\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868831338665,"sku":"10209-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10209-2-ap","provider":"Iright","version":"1.0","type":"link"}