{"product_id":"proteintech-10211-1-ap","title":"Proteintech, 10211-1-AP, HSPBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPBP1 (10211-1-AP) by Proteintech is a Polyclonal antibody targeting HSPBP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10211-1-AP targets HSPBP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  human heart tissue,  human skeletal muscle tissue,  human testis tissue,  Jurkat cells,  MCF-7 cells,  mouse brain tissue,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human kidney tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHsp70-interacting protein (HSPBP1)is a protein of approximately 40 kilodaltons detected in cell extracts. Its mRNA is present in all tissues analyzed but is most abundant in heart and skeletal muscle. HSPBP1 binds the ATPase domain of Hsp70 and inhibits approximately 90% of the Hsp40-activated Hsp70 ATPase activity by preventing ATP binding to Hsp70.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0282 Product name: Recombinant human HSPBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-359 aa of BC002373 Sequence: DFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR Predict reactive species\nFull Name: HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC002373\nGene Symbol: HSPBP1\nGene ID (NCBI): 23640\nRRID: AB_2121242\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZL4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869549351081,"sku":"10211-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10211-1-ap","provider":"Iright","version":"1.0","type":"link"}