{"product_id":"proteintech-10213-2-ap","title":"Proteintech, 10213-2-AP, RABEPK\/p40 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RABEPK\/p40 (10213-2-AP) by Proteintech is a Polyclonal antibody targeting RABEPK\/p40 in WB, IHC, ELISA applications with reactivity to human samples\n10213-2-AP targets RABEPK\/p40 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, K-562 cells,  HeLa cells\nPositive IHC detected in: human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab9 GTPase is required for the transport of mannose 6-phosphate receptors from endosomes to the trans-Golgi network in living cells, and in an in vitro system that reconstitutes this process. P40 is an effector of Rab9 that interacts preferentially with the active form of Rab9. p40 does not interact with Rab7 or K-Ras; it also fails to bind Rab9 when it is bound to GDI. The protein is found in cytosol, yet a significant fraction (~30%) is associated with cellular membranes. P40 is a very potent transport factor in that the pure, recombinant protein can stimulate, significantly, an in vitro transport assay that measures transport of mannose 6-phosphate receptors from endosomes to the trans-Golgi network.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0285 Product name: Recombinant human RABEPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-355 aa of BC000503 Sequence: AQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEGSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGG Predict reactive species\nFull Name: Rab9 effector protein with kelch motifs\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC000503\nGene Symbol: RABEPK\/p40\nGene ID (NCBI): 10244\nRRID: AB_2238057\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z6M1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778648233,"sku":"10213-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10213-2-ap","provider":"Iright","version":"1.0","type":"link"}