{"product_id":"proteintech-10222-1-ap","title":"Proteintech, 10222-1-AP, Sam68 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Sam68 (10222-1-AP) by Proteintech is a Polyclonal antibody targeting Sam68 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10222-1-AP targets Sam68 in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HT-29 cells,  mouse brain tissue,  NIH\/3T3 cells,  mouse embryo tissue,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKHDRBS1, also named as SAM68, p62and p68, belongs to the KHDRBS family. It is recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and INS receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and\/or translation rates and mediates mRNA nuclear export. KHDRBS1 has three isoforms with calculated MW of 44-48kd. For isoform with a calculated MW of 48.2 kD, it migrated as a 68kD protein on SDS-PAGE gels[PMID: 10564820]. This ia a rabbit polyclonal antibody raised against residues near the N terminus of human Sam68.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0235 Product name: Recombinant human Sam68 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-442 aa of BC000717 Sequence: GSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGR Predict reactive species\nFull Name: KH domain containing, RNA binding, signal transduction associated 1\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC000717\nGene Symbol: Sam68\nGene ID (NCBI): 10657\nRRID: AB_2130292\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q07666\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914438313,"sku":"10222-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10222-1-ap","provider":"Iright","version":"1.0","type":"link"}