{"product_id":"proteintech-10238-1-ap","title":"Proteintech, 10238-1-AP, PLEKHA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEKHA1 (10238-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHA1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10238-1-AP targets PLEKHA1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue,  Jurkat cells\nPositive IHC detected in: human colon tissue,  human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPleckstrin homology (PH) domain is commonly found in eukaryotic signaling proteins and possesses multiple functions including the abilities to bind inositol phosphates and various proteins. The tandem PH domain containing protein-1 (TAPP1) or PH domain containing-family A (phosphoinositide binding specific) member 1 (PLEKHA1), interacts strongly and specifically with phosphatidylinositol 3,4-trisphosphate [PtdIns(3,4)P(2)], which is one of the immediate breakdown products of PtdIns(3,4,5) P (3) and functions as a signalling molecule in insulin- and growth-factor-stimulated pathways. TAPP1 is also associated with the protein-\ttyrosine-phosphatase-like protein-1 (PTPL1 also known as FAP-1) and maintains PTPL1 in cytoplasm. By binding to PtdIns(3,4) P (2) and PTPL1, TAPP1 may regulate the membrane localization of PTPL1.\"\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0318 Product name: Recombinant human PLEKHA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC001136 Sequence: MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIKLTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVI Predict reactive species\nFull Name: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC001136\nGene Symbol: PLEKHA1\nGene ID (NCBI): 59338\nRRID: AB_2163993\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HB21\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868986757289,"sku":"10238-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10238-1-ap","provider":"Iright","version":"1.0","type":"link"}