{"product_id":"proteintech-10241-2-ap","title":"Proteintech, 10241-2-AP, CBX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CBX1 (10241-2-AP) by Proteintech is a Polyclonal antibody targeting CBX1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10241-2-AP targets CBX1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MCF-7 cells,  HEK-293 cells,  human brain tissue,  NIH\/3T3 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach cancer tissue, mouse testis tissue,  human colon cancer tissue,  human lung cancer tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOne function of heterochromatin is the epigenetic silencing by sequestration of genes into transcriptionally repressed nuclear neighborhoods. Heterochromatin protein 1 (HP1) is a major component of heterochromatin and is a candidate for establishing and mediating gene silencing. This protein is expressed  in all adult and embryonic tissues, as a homodimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0328 Product name: Recombinant human CBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-185 aa of BC002609 Sequence: NKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN Predict reactive species\nFull Name: chromobox homolog 1 (HP1 beta homolog Drosophila )\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC002609\nGene Symbol: CBX1\nGene ID (NCBI): 10951\nRRID: AB_2228586\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P83916\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868923318441,"sku":"10241-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10241-2-ap","provider":"Iright","version":"1.0","type":"link"}