{"product_id":"proteintech-10278-1-ap","title":"Proteintech, 10278-1-AP, TRAPB\/SSR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAPB\/SSR2 (10278-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPB\/SSR2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10278-1-AP targets TRAPB\/SSR2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human breast cancer tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRAPB (translocon-associated protein subunit beta), also known as SSR2 (signal sequence receptor subunit beta), is a 22-kDa single-spanning membrane glycoprotein of the endoplasmic reticulum (ER) (PMID: 7789174). It is a part of the tetrameric TRAP complex (TRAP-alpha, TRAP-beta, TRAP-delta and TRAP-gamma) which functions in regulating the retention of ER resident proteins (PMID: 7916687). The TRAP complex is also involved in endoplasmic reticulum-associated degradation (ERAD) (PMID: 17380188).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0304 Product name: Recombinant human TRAPB, SSR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC000341 Sequence: MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKY Predict reactive species\nFull Name: signal sequence receptor, beta (translocon-associated protein beta)\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC000341\nGene Symbol: TRAPB\nGene ID (NCBI): 6746\nRRID: AB_2195624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43308\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937736361,"sku":"10278-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10278-1-ap","provider":"Iright","version":"1.0","type":"link"}