{"product_id":"proteintech-10310-1-ap","title":"Proteintech, 10310-1-AP, MPV17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPV17 (10310-1-AP) by Proteintech is a Polyclonal antibody targeting MPV17 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10310-1-AP targets MPV17 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMPV17, also termed as SYM1, encodes an inner mitochondrial membrane protein. It's potential candidate that may account for the mitochondrial (mt) DNA depletion syndromes (MDDS) characterized by a severe, tissue-specific decrease of mtDNA copy number and ultimate organ failure. It's a human ortholog of the mouse kidney disease gene Mpv17. Absence or malfunction of MPV17 causes oxidative phosphorylation (OXPHOS) failure and mtDNA depletion, not only in affected individuals but also in Mpv17-\/- mice. MPV17 contribute to ROS homeostasis, but the downstream signaling is unknown yet. Catalog# 10310-1-AP is a rabbit polyclonal antibody raised against the full-length of human MPV17.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0312 Product name: Recombinant human MPV17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC001115 Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHR Predict reactive species\nFull Name: MpV17 mitochondrial inner membrane protein\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC001115\nGene Symbol: MPV17\nGene ID (NCBI): 4358\nRRID: AB_2144642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P39210\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868925907113,"sku":"10310-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10310-1-ap","provider":"Iright","version":"1.0","type":"link"}