{"product_id":"proteintech-10329-1-ap","title":"Proteintech, 10329-1-AP, SUMO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUMO1 (10329-1-AP) by Proteintech is a Polyclonal antibody targeting SUMO1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n10329-1-AP targets SUMO1 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  NIH\/3T3 cells,  PC-12 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmall ubiquitin-related modifier 1 (SUMO1) belongs to the ubiquitin family and the SUMO subfamily as it contains 1 ubiquitin-like domain and is also 18% identical to ubiquitin (PMID: 9654451).1. What is the molecular weight of SUMO1?The molecular weight of SUMO1 is 12 kDa.2. What is the cellular localization of SUMO1?SUMO1 is located in the nuclear membrane and is recruited by BCL11A to the nuclear body (PMID: 18681895).3. What modifications is SUMO1 subjected to?SUMO1 function occurs after the cleavage of its precursor form by SENP1 or SENP2 (PMID: 27576863). Polymeric SUMO1 chains also undergo polyubiquitination by RNF4 (PMID: 18408734).4. What is the function of SUMO1?SUMO1 post-translationally modifies many proteins that have roles in an array of processes including transcriptional regulation, chromatin structure, and DNA repair. SUMO1 can covalently attach itself to protein as a monomer or a lysine-linked polymer via an isopeptide bond (PMID:11124955). This SUMO modification can regulate the localization and activity of the affected proteins.5. What is SUMO1's involvement in disease?Defects in SUMO1 as a result of a chromosomal translocation are associated with non-syndromic orofacial cleft type 10, or non-syndromic cleft lip, and are associated with cleft palate in two-thirds of cases (PMID: 18983974).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0414 Product name: Recombinant human SUMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC006462 Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV Predict reactive species\nFull Name: SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae)\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12~18 kDa, 80-90 kDa\nGenBank Accession Number: BC006462\nGene Symbol: SUMO1\nGene ID (NCBI): 7341\nRRID: AB_2286872\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63165\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868853620905,"sku":"10329-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10329-1-ap","provider":"Iright","version":"1.0","type":"link"}