{"product_id":"proteintech-10331-1-ap","title":"Proteintech, 10331-1-AP, RARA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RARA (10331-1-AP) by Proteintech is a Polyclonal antibody targeting RARA in WB, ELISA applications with reactivity to human, mouse, rat samples\n10331-1-AP targets RARA in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MCF-7 cells,  MDA-MB-231 cells,  NIH\/3T3 cells,  T-47D cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRetinoic acid receptors (RARs) function as nuclear receptors that control gene expression in response to binding of the ligand retinoic acid (RA). Retinoic acid receptor alpha (RARα), also known as NR1B1 (nuclear receptor subfamily 1, group B, member 1), plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Formation of a complex with histone deacetylases might lead to inhibition of RARE DNA element binding and to transcriptional repression (PubMed:28167758). Transcriptional activation and RARE DNA element binding might be supported by the transcription factor KLF2 (PubMed:28167758).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0420 Product name: Recombinant human RARA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 80-421 aa of BC008727 Sequence: PLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLD Predict reactive species\nFull Name: retinoic acid receptor, alpha\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC008727\nGene Symbol: RARA\nGene ID (NCBI): 5914\nRRID: AB_2177742\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10276\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936196265,"sku":"10331-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10331-1-ap","provider":"Iright","version":"1.0","type":"link"}