{"product_id":"proteintech-10346-1-ap","title":"Proteintech, 10346-1-AP, CTBP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTBP2 (10346-1-AP) by Proteintech is a Polyclonal antibody targeting CTBP2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n10346-1-AP targets CTBP2 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse heart tissue,  rat brain tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human pancreas cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-Terminal binding protein 2 (CTBP2) is a transcriptional repressor. It contains a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. This protein is thought to bind to the C-terminus of the adenovirus E1A proteins.  Studies in mice suggested that this protein is involved in transcriptional repression. CTBP2 is expressed in all tissues tested, with a higher level of expression in the heart, skeletal muscle, and pancreas. The gene of CTBP2 is mapped to human chromosome 21q21.3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, zebrafish, gerbil\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0352 Product name: Recombinant human CTBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-201 aa of BC002486 Sequence: QIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKA Predict reactive species\nFull Name: C-terminal binding protein 2\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC002486\nGene Symbol: CTBP2\nGene ID (NCBI): 1488\nRRID: AB_2261202\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56545\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868916699305,"sku":"10346-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10346-1-ap","provider":"Iright","version":"1.0","type":"link"}