{"product_id":"proteintech-10373-2-ap","title":"Proteintech, 10373-2-AP, MMP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP2 (10373-2-AP) by Proteintech is a Polyclonal antibody targeting MMP2 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n10373-2-AP targets MMP2 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, MCF-7 cells,  U-87 MG cells,  HepG2 cells,  U-251 cells,  J774A.1 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human gliomas tissue, human placenta tissue,  human prostate cancer tissue,  human heart tissue,  human oesophagus tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd). Western blot analysis showed that the 72 kDa and 62\/65 kDa proteinase activities were pro-MMP2 and the active enzyme, respectively (PMID:11112697,PMID: 30867536).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, rabbit, monkey, bovine, fish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0549 Product name: Recombinant human MMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 461-660 aa of BC002576 Sequence: LGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC Predict reactive species\nFull Name: matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 62-72 kDa\nGenBank Accession Number: BC002576\nGene Symbol: MMP2\nGene ID (NCBI): 4313\nRRID: AB_2250823\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08253\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868817281193,"sku":"10373-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10373-2-ap","provider":"Iright","version":"1.0","type":"link"}