{"product_id":"proteintech-10379-1-ap","title":"Proteintech, 10379-1-AP, SNRPD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPD3 (10379-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPD3 in WB, IHC, ELISA applications with reactivity to human samples\n10379-1-AP targets SNRPD3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells,  MCF-7 cells\nPositive IHC detected in: human small intestine tissue, human breast cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmall nuclear ribonucleoprotein D3 polypeptide 18kDa (SNRPD3,synonym: SMD) belongs to the small nuclear ribonucleoprotein core protein family, with molecular weights of the D members: D1,16 kDa; D2, 16.5 kDa and D3 18 kDa. SNRPD3 is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0293 Product name: Recombinant human SNRPD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-119 aa of BC000457 Sequence: EGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRG Predict reactive species\nFull Name: small nuclear ribonucleoprotein D3 polypeptide 18kDa\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC000457\nGene Symbol: SNRPD3\nGene ID (NCBI): 6634\nRRID: AB_2286308\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62318\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869603516585,"sku":"10379-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10379-1-ap","provider":"Iright","version":"1.0","type":"link"}