{"product_id":"proteintech-10390-1-ap","title":"Proteintech, 10390-1-AP, HGS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HGS (10390-1-AP) by Proteintech is a Polyclonal antibody targeting HGS in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10390-1-AP targets HGS in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human liver tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHepatocyte growth factor-regulated tyrosine kinase substrate (HGS, synonyms: HRS, ZFYVE8) is a 110 to 115-kDa zinc finger phosphotyrosine protein inducible by stimulation with interleukin 2 (IL-2), granulocyte-macrophage colony-stimulating factor (GM-CSF) as well as hepatocyte growth factor (HGF), and is associated with signal-transducing adaptor molecule (STAM). HGS suppresses DNA synthesis upon stimulation with IL-2 and GM-CSF, counteracting STAM's function, which is critical for cell growth signaling mediated by the cytokines. HGS also interacts with the neurofibromatosis 2 tumor suppressor protein Schwannomin\/merlin. The growth suppression activity of schwannoma\/merlin requires HGS. The binding of schwannoma\/merlin to HGS facilitates its ability to function as a tumor suppressor, probably by inhibiting STAT activation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0589 Product name: Recombinant human HGS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 186-387 aa of BC003565 Sequence: GQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPS Predict reactive species\nFull Name: hepatocyte growth factor-regulated tyrosine kinase substrate\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC003565\nGene Symbol: HGS\nGene ID (NCBI): 9146\nRRID: AB_2118914\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14964\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868897824937,"sku":"10390-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10390-1-ap","provider":"Iright","version":"1.0","type":"link"}