{"product_id":"proteintech-10391-1-ap","title":"Proteintech, 10391-1-AP, UGP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UGP2 (10391-1-AP) by Proteintech is a Polyclonal antibody targeting UGP2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10391-1-AP targets UGP2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse liver tissue,  L02 cells,  rat liver tissue\nPositive IHC detected in: human ovary tumor tissue, human kidney tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunohistochemistry (IHC): IHC : 1:100-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUDP-glucose pyrophosphorylase 2 (UGP2, synonyms: UDPG, UGPP2, UDPGP2, Phc379)is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. So far two isoforms are encoded by two transcript variants have been found.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0590 Product name: Recombinant human UGP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-288 aa of BC002954 Sequence: SQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYE Predict reactive species\nFull Name: UDP-glucose pyrophosphorylase 2\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 50-56 kDa\nGenBank Accession Number: BC002954\nGene Symbol: UGP2\nGene ID (NCBI): 7360\nRRID: AB_2272775\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16851\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869389607081,"sku":"10391-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10391-1-ap","provider":"Iright","version":"1.0","type":"link"}