{"product_id":"proteintech-10392-1-ap","title":"Proteintech, 10392-1-AP, USP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP2 (10392-1-AP) by Proteintech is a Polyclonal antibody targeting USP2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n10392-1-AP targets USP2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, mouse brain tissue,  mouse kidney tissue,  MCF-7 cells,  HEK-293 cells\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissue,  human skeletal muscle tissue,  mouse kidney tissue,  rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse embryo tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin, a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). USP2 is also named as UBP41. USP2 can interact indirectly with multiple clock proteins, so it remains possible that USP2 may modulate the ubiquitination and function of these other proteins. It has 4 isoforms produced by alternative splicing. This antibody is specific to the  isoform 1(USP2a) of USP2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0591 Product name: Recombinant human USP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-241 aa of BC002955 Sequence: YTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGK Predict reactive species\nFull Name: ubiquitin specific peptidase 2\nCalculated Molecular Weight: 41 kDa, 69 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC002955\nGene Symbol: USP2\nGene ID (NCBI): 9099\nRRID: AB_2212432\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75604\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868875411625,"sku":"10392-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10392-1-ap","provider":"Iright","version":"1.0","type":"link"}