{"product_id":"proteintech-10396-1-ap","title":"Proteintech, 10396-1-AP, ANGPTL7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANGPTL7 (10396-1-AP) by Proteintech is a Polyclonal antibody targeting ANGPTL7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10396-1-AP targets ANGPTL7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANGPTL7, also named as CDT6, is a member of the angiopoietin-like (ANGPTL) family of proteins,  which are important regulators of Angiogenesis. It is a secreted 45-kDa glycoprotein that folds into a homotetramer structure linked by disulﬁde bonds. ANGPTL7 was originally discovered in the stromal layer of the corne, and moderately expressed in the human trabecular meshwork. The chromosomal location of the ANGPTL7 gene (1p36.22) is within the GLC3B locus (1p36.2-1p36.1) of primary congenital glaucoma, supporting ANGPTL7 as a candidate glaucoma gene. ANGPTL7 could have a  pathogenic role in glaucoma, and may serve as a potential therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0596 Product name: Recombinant human ANGPTL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-334 aa of BC001881 Sequence: NCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKR Predict reactive species\nFull Name: angiopoietin-like 7\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC001881\nGene Symbol: ANGPTL7\nGene ID (NCBI): 10218\nRRID: AB_2057556\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43827\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868947108009,"sku":"10396-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10396-1-ap","provider":"Iright","version":"1.0","type":"link"}