{"product_id":"proteintech-10401-1-ap","title":"Proteintech, 10401-1-AP, RAIDD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nRAIDD Polyclonal Antibody for WB, IP, IHC, ELISA\n10401-1-AP targets RAIDD in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HEK-293 cells,  HeLa cells,  MCF-7 cells,  mouse heart tissue,  mouse kidney tissue,  mouse liver tissue,  mouse skeletal muscle tissue,  mouse testis tissue,  Raji cells\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAIDD, also named as CRADD, is an apoptotic adaptor molecule specific for caspase-2 and FASL\/TNF receptor-interacting protein RIP. In the presence of RIP and TRADD, CRADD recruits caspase-2 to the TNFR-1 signalling complex. CRADD interacts with BCL10 through its caspase recruitment domain and suppresses interactions between BCL10 and CARMA1. It is a negative regulator of the CARMA1 signalosome and suppressor of Th1-and Th17-mediated inflammatory responses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0630 Product name: Recombinant human CRADD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC017042 Sequence: MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE Predict reactive species\nFull Name: CASP2 and RIPK1 domain containing adaptor with death domain\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC017042\nGene Symbol: CRADD\nGene ID (NCBI): 8738\nRRID: AB_2085477\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78560\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868987510953,"sku":"10401-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10401-1-ap","provider":"Iright","version":"1.0","type":"link"}