{"product_id":"proteintech-10402-1-ap","title":"Proteintech, 10402-1-AP, BCAS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCAS3 (10402-1-AP) by Proteintech is a Polyclonal antibody targeting BCAS3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n10402-1-AP targets BCAS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, A431 cells,  HeLa cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRudhira\/BCAS3 (Breast Cancer Amplified Sequence 3) is a conserved protein expressed in the embryonic vasculature and malignant tumors. Rudhira is a predicted WD40 domain protein. During mouse development Rudhira is expressed in erythropoietic and angiogenic precursors but not in their differentiated progeny. This transient expression of Rudhira is also seen in normal adult angiogenesis. BCAS3, the human ortholog of Rudhira is 98% identical and the gene maps to a breakpoint of hematological neoplasms on chromosome 17q23.1. BCAS3 is also expressed in vascular development in embryoid bodies in vitro and was originally identified as a gene over-expressed in breast cancers. It is reported to be a target of metastasis associated protein-1 (MTA-1). Further BCAS3 expression is also upregulated in grade III and IV glioblastomas where it is misexpressed in the tumor cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0646 Product name: Recombinant human BCAS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 653-928 aa of BC001250 Sequence: SWTLVRTPQWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP Predict reactive species\nFull Name: breast carcinoma amplified sequence 3\nCalculated Molecular Weight: 99 kDa\nObserved Molecular Weight: 74 kDa\nGenBank Accession Number: BC001250\nGene Symbol: BCAS3\nGene ID (NCBI): 54828\nRRID: AB_10897181\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6U6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885202657449,"sku":"10402-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10402-1-ap","provider":"Iright","version":"1.0","type":"link"}