{"product_id":"proteintech-10405-1-ap","title":"Proteintech, 10405-1-AP, Cytohesin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytohesin 2 (10405-1-AP) by Proteintech is a Polyclonal antibody targeting Cytohesin 2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n10405-1-AP targets Cytohesin 2 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human colon tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPleckstrin homology, Sec7 and coiled\/coil domains 2 (PSCD2) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. PSCD2 exhibits GEP activity in vitro with small G proteins ARF1, ARF3, and ARF6.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0687 Product name: Recombinant human CYTH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-384 aa of BC004361 Sequence: VDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEML Predict reactive species\nFull Name: cytohesin 2\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC004361\nGene Symbol: Cytohesin 2\nGene ID (NCBI): 9266\nRRID: AB_2089028\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99418\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869402157225,"sku":"10405-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10405-1-ap","provider":"Iright","version":"1.0","type":"link"}