{"product_id":"proteintech-10414-1-ap","title":"Proteintech, 10414-1-AP, BCAS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCAS2 (10414-1-AP) by Proteintech is a Polyclonal antibody targeting BCAS2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples\n10414-1-AP targets BCAS2 in WB, IHC, IF\/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue,  mouse liver tissue,  hESC cells,  human brain tissue,  K-562 cells,  COS-7 cells,  SH-SY5Y cells,  PC-12 cells,  C6 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human prostate cancer tissue, human colon cancer tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCAS2 associates with the spliceosome and implicates in mRNA splicing\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0669 Product name: Recombinant human BCAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC005285 Sequence: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF Predict reactive species\nFull Name: breast carcinoma amplified sequence 2\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26-32 kDa\nGenBank Accession Number: BC005285\nGene Symbol: BCAS2\nGene ID (NCBI): 10286\nRRID: AB_2063400\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75934\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868963098793,"sku":"10414-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10414-1-ap","provider":"Iright","version":"1.0","type":"link"}