{"product_id":"proteintech-10439-1-ap","title":"Proteintech, 10439-1-AP, EIF3J Polyclonal antibody","description":"Size: 20ul \/ 150ul\nEIF3J Polyclonal Antibody for WB, IHC, IF\/ICC, IP, ELISA\n10439-1-AP targets EIF3J in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  A549 cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  MCF-7 cells,  SKOV-3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF3 has a key role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex(PMID:17588516). The eIF3 complex stimulates several steps in the translation initiation pathway, including dissociation of 80S ribosomes into 40S and 60S subunits, binding of a ternary complex (TC) consisting of Met-tRNA , eIF2, and GTP to the small subunit (forming the 43S preinitiation complex) and recruitment of mRNA to the 43 S complex to produce the 48S complex (PMID:11560931) EIF3J was identified as a high copy suppressor of the temperature-sensitive (Ts-) phenotype of the rpg1-1 allele of TIF32\/RPG1, encoding the largest subunit of yeast eIF3 (eIF3a) (PMID:10488093).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0678 Product name: Recombinant human EIF3J protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC002719 Sequence: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM Predict reactive species\nFull Name: eukaryotic translation initiation factor 3, subunit J\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC002719\nGene Symbol: EIF3J\nGene ID (NCBI): 8669\nRRID: AB_2097082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75822\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869404680361,"sku":"10439-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10439-1-ap","provider":"Iright","version":"1.0","type":"link"}