{"product_id":"proteintech-10444-1-ap","title":"Proteintech, 10444-1-AP, SLC43A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC43A1 (10444-1-AP) by Proteintech is a Polyclonal antibody targeting SLC43A1 in WB, IHC, ELISA applications with reactivity to human samples\n10444-1-AP targets SLC43A1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, Daudi cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC43A1, also named as LAT3, PB39 and POV1, belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids. It plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0305 Product name: Recombinant human SLC43A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 107-320 aa of BC001639 Sequence: RLVGSACFTASCTLMALASRDVEALSPLIFLALSLNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAITFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCSPTFLWSLLTMGMTQLRIIF Predict reactive species\nFull Name: solute carrier family 43, member 1\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 55-61 kDa\nGenBank Accession Number: BC001639\nGene Symbol: SLC43A1\nGene ID (NCBI): 8501\nRRID: AB_2302076\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75387\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869766209705,"sku":"10444-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10444-1-ap","provider":"Iright","version":"1.0","type":"link"}