{"product_id":"proteintech-10445-1-ap","title":"Proteintech, 10445-1-AP, Histone H2A type 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H2A type 3 (10445-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H2A type 3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n10445-1-AP targets Histone H2A type 3 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone H2A type 3, it is expected to be located in the nucleus, and the protein is enriched in the brain tissue. Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. The molecular weight of Histone H2A type 3 is 14 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0374 Product name: Recombinant human HIST3H2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC001193 Sequence: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK Predict reactive species\nFull Name: histone cluster 3, H2a\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14-18 kDa\nGenBank Accession Number: BC001193\nGene Symbol: Histone H2A type 3\nGene ID (NCBI): 92815\nRRID: AB_2116701\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7L7L0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869411430569,"sku":"10445-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10445-1-ap","provider":"Iright","version":"1.0","type":"link"}