{"product_id":"proteintech-10446-1-ap","title":"Proteintech, 10446-1-AP, NGFRAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NGFRAP1 (10446-1-AP) by Proteintech is a Polyclonal antibody targeting NGFRAP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10446-1-AP targets NGFRAP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse liver tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0378 Product name: Recombinant human NGFRAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-111 aa of BC003190 Sequence: IHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP Predict reactive species\nFull Name: nerve growth factor receptor (TNFRSF16) associated protein 1\nCalculated Molecular Weight: 13 kDa, 22 kDa, 44 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC003190\nGene Symbol: NGFRAP1\nGene ID (NCBI): 27018\nRRID: AB_2152792\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00994\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887736508585,"sku":"10446-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10446-1-ap","provider":"Iright","version":"1.0","type":"link"}