{"product_id":"proteintech-10457-1-ap","title":"Proteintech, 10457-1-AP, UBC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBC (10457-1-AP) by Proteintech is a Polyclonal antibody targeting UBC in IHC, ELISA applications with reactivity to human, mouse, rat samples\n10457-1-AP targets UBC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissue, human lung cancer tissue,  human urothelial carcinoma tissue,  mouse stomach tissue,  rat liver tissue,  rat pancreas tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin (Ub) is a small, highly conserved eukaryotic protein that has an essential role in diverse cellular signaling pathways, including targeting proteins for proteasomal degradation. Cellular Ub is comprised of two distinct pools consisting of free Ub and Ub-substrate conjugates. UbC is a polyubiquitine gene that encodes Ub polyprotein. UbC, as stress-inducible polyubiquitin precursor proteins of around 9-11 monomers, is cleaved into monomeric ubiquitin by cellular deubiquitylating enzymes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0711 Product name: Recombinant human UBC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-265 aa of BC008955 Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE Predict reactive species\nFull Name: ubiquitin C\nCalculated Molecular Weight: 60 kDa\nGenBank Accession Number: BC008955\nGene Symbol: UBC\nGene ID (NCBI): 7316\nRRID: AB_2241301\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0CG48\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869506785449,"sku":"10457-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10457-1-ap","provider":"Iright","version":"1.0","type":"link"}