{"product_id":"proteintech-10463-1-ap","title":"Proteintech, 10463-1-AP, EIF4A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF4A3 (10463-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4A3 in WB, IP, ELISA applications with reactivity to human,  mouse samples\n10463-1-AP targets EIF4A3 in WB, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  human lung tissue,  mouse liver tissue,  Raji cells\nPositive IP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF4A3 is a component of the exon junction complex (EJC), which assembles near exon-exon junctions of mRNAs as a result of splicing. EJC proteins involves in postsplicing events, including mRNA export, cytoplasmic localization, and nonsense-mediated decay. Its RNA-dependent ATPase and RNA-helicase activities are induced by CASC3, but abolished in presence of the MAGOH\/RBM8A heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. Besides, it involved in translational enhancement of spliced mRNAs after formation of the 80S ribosome complex and binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0733 Product name: Recombinant human EIF4A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC004386 Sequence: MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL Predict reactive species\nFull Name: eukaryotic translation initiation factor 4A, isoform 3\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC004386\nGene Symbol: EIF4A3\nGene ID (NCBI): 9775\nRRID: AB_2097394\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P38919\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869404745897,"sku":"10463-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10463-1-ap","provider":"Iright","version":"1.0","type":"link"}