{"product_id":"proteintech-10465-1-ap","title":"Proteintech, 10465-1-AP, LAMA4 (Isoform 3) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LAMA4 (Isoform 3) (10465-1-AP) by Proteintech is a Polyclonal antibody targeting LAMA4 (Isoform 3) in WB, IHC, ELISA applications with reactivity to human samples\n10465-1-AP targets LAMA4 (Isoform 3) in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, human skeletal muscle tissue\nPositive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLaminin is a basement membrane glycoprotein composed of three nonidentical chains, A, B1, and B2 (PMID: 7959779). LAMA4 (laminin, alpha 4), an A chain variant, is a subunit of laminin-8 (laminin-411), laminin-9 (laminin-421) and laminin-14 (laminin-423) (PMID: 10842354; 10964957). LAMA4 is widely distributed in developing and adult human tissues, and mainly localized to mesenchyme-derived tissues (PMID: 12133914). It may have a role in formation and function of endothelium, transmigration of inflammatory cells through endothelium, and invasion of certain tumors (PMID: 17533363). Three alternatively spliced mRNAs give rise to three isoforms. This antibody was generated against the full length (1-120aa) of isoform 3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0736 Product name: Recombinant human LAMA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC004241 Sequence: MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL Predict reactive species\nFull Name: laminin, alpha 4\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 11-13 kDa\nGenBank Accession Number: BC004241\nGene Symbol: Laminin alpha 4\/LAMA4\nGene ID (NCBI): 3910\nRRID: AB_2234461\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16363\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868969160873,"sku":"10465-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10465-1-ap","provider":"Iright","version":"1.0","type":"link"}