{"product_id":"proteintech-10468-1-ap","title":"Proteintech, 10468-1-AP, CXCL14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL14 (10468-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL14 in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10468-1-AP targets CXCL14 in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver tissue,  human breast cancer tissue,  human colon cancer tissue,  human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL 14 (C-X-C motif chemokine 14) is a small inducible cytokine, and may be a potent chemoattractant for neutrophils. CXCL14 possesses a destruction box (D-box) domain which acts as a recognition signal for degradation via the ubiquitin-proteasome pathway. CXCL14 is widely expressed in normal tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas without inflammatory stimuli. It is dispensable for dendritic cell function and localization within peripheral tissues. In localized prostate cancer, CXCL14 mRNA was significantly upregulated and positively correlated with Gleason score.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0747 Product name: Recombinant human CXCL14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC003513 Sequence: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 14\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC003513\nGene Symbol: CXCL14\nGene ID (NCBI): 9547\nRRID: AB_2086070\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95715\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868933017769,"sku":"10468-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10468-1-ap","provider":"Iright","version":"1.0","type":"link"}