{"product_id":"proteintech-10480-1-ap","title":"Proteintech, 10480-1-AP, Prothymosin Alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Prothymosin Alpha (10480-1-AP) by Proteintech is a Polyclonal antibody targeting Prothymosin Alpha in IHC, ELISA applications with reactivity to human, rat samples\n10480-1-AP targets Prothymosin Alpha in IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human thyroid cancer tissue, human lymphoma tissue,  rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:100-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProthymosin alpha (PTMA) is a nuclear protein possessing a number of cellular functions including cell survival. PTMA is identified to be localized in the nuclei of neurons, while it is found in both nuclei and cytoplasm in the astrocytes and microglia of adult brai. PTMA inhibits the neuronal necrosis induced by serum-free starvation or ischemia-reperfusion stress, which causes a rapid internalization of GLUT1\/4, leading a decrease in glucose uptake and cellular ATP levels. Extensive research on PTMA showed that it is of clinical significance and potential medical use as they may serve as a molecular marker for cancer prognosis and\/or as therapeutic agents for treating immunodeficiencies, autoimmune diseases and malignancies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0732 Product name: Recombinant human PTMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC003510 Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD Predict reactive species\nFull Name: prothymosin, alpha\nCalculated Molecular Weight: 12 kDa\nGenBank Accession Number: BC003510\nGene Symbol: Prothymosin Alpha\/PTMA\nGene ID (NCBI): 5757\nRRID: AB_2174388\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06454\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887774453929,"sku":"10480-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10480-1-ap","provider":"Iright","version":"1.0","type":"link"}