{"product_id":"proteintech-10481-2-ap","title":"Proteintech, 10481-2-AP, DOK4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DOK4 (10481-2-AP) by Proteintech is a Polyclonal antibody targeting DOK4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n10481-2-AP targets DOK4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe INS-receptor substrate family plays important roles in cellular growth, signaling and survival. IRS5\/DOK4 is a new member of this family identified, which is known as docking protein 4, or downstream of tyrosine kinase-4. DOK4 might have roles in INS and IGF-1 signaling as well. Expression of IRS5\/DOK4 is regulated epigenetically via histone acetylating at its promoter. DOK4 is required at early stages in the myelination process, including the initial interaction with the axon, and is also involved in Schwann cell migration and proliferation, it also regulates GDNF-mediated neurite outgrowth during neuronal development through activation of the Rap1-ERK1\/2 pathway. DOK4 may represent a novel negative regulator of T cells as other DOK family members like DOK1 and DOK2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0734 Product name: Recombinant human DOK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-326 aa of BC003541 Sequence: TLAIAEQHKRVLLEMEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPSQ Predict reactive species\nFull Name: docking protein 4\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC003541\nGene Symbol: DOK4\nGene ID (NCBI): 55715\nRRID: AB_2246205\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TEW6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887292731561,"sku":"10481-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10481-2-ap","provider":"Iright","version":"1.0","type":"link"}