{"product_id":"proteintech-10509-1-ig","title":"Proteintech, 10509-1-Ig, RhoGDI Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RhoGDI (10509-1-Ig) by Proteintech is a Polyclonal antibody targeting RhoGDI in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10509-1-Ig targets RhoGDI in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A431 cells,  mouse pancreas tissue,  HL-60 cells,  HeLa cells,  HEK-293 cells\nPositive IHC detected in: human breast cancer tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRho GDP-dissociation inhibitor (RhoGDI), also called ARHGDIA, is one member of ARHGDIs, which is ubiquitously expressed and interacts with several Rho GTPases, mainly including RhoA, Rac1, and Cdc42. RhoGDI can inhibit nucleotide exchange and membrane association to downregulate the activities of Rho family GTPase. It is overexpressed in various human cancers. Activity of this protein is important in a variety of cellular processes, and it is overexpressed in various human cancers. Mutations in RhoGDI have been found in individuals with nephrotic syndrome, type 8.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0791 Product name: Recombinant human ARHGDIA,aGDI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC005851 Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD Predict reactive species\nFull Name: Rho GDP dissociation inhibitor (GDI) alpha\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC005851\nGene Symbol: RhoGDI\nGene ID (NCBI): 396\nRRID: AB_2059582\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P52565\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868929773737,"sku":"10509-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10509-1-ig","provider":"Iright","version":"1.0","type":"link"}